PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10009497m
Common NameCARUB_v10009497mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 370aa    MW: 41141.7 Da    PI: 8.0759
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10009497mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++ +G g+W+++++  g+ R++k+c++rw +yl
  Carubv10009497m 14 KGLWSPEEDEKLLNHITNHGHGCWSSVPKLAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding48.42.2e-1567109145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      rg++++eE+ l+v++++ lG++ W+ Ia++++ gRt++++k+ w+
  Carubv10009497m  67 RGAFSPEEENLIVELHAALGNR-WSQIASRLP-GRTDNEIKNLWN 109
                      89********************.*********.*********998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-27664IPR009057Homeodomain-like
PROSITE profilePS5129417.738961IPR017930Myb domain
SuperFamilySSF466895.62E-2912108IPR009057Homeodomain-like
SMARTSM007176.8E-121363IPR001005SANT/Myb domain
PfamPF002496.0E-151461IPR001005SANT/Myb domain
CDDcd001674.73E-111761No hitNo description
PROSITE profilePS5129424.78262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-2565117IPR009057Homeodomain-like
SMARTSM007178.9E-1466114IPR001005SANT/Myb domain
PfamPF002493.3E-1467109IPR001005SANT/Myb domain
CDDcd001672.33E-1069109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009733Biological Processresponse to auxin
GO:0010089Biological Processxylem development
GO:0010119Biological Processregulation of stomatal movement
GO:0010214Biological Processseed coat development
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLNHIT NHGHGCWSSV PKLAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SPEEENLIVE LHAALGNRWS QIASRLPGRT DNEIKNLWNS SIKKKLKQRG  120
IDPNTHKPIS EVESFSDRDK PTTTSNNKRI GNDHKSPSSS SATNQDFFLE RPSDFSDFFG  180
FQKLNFNSSL GLSVTTDSSL CSMIPPQFSS GNMVVGSVFQ TPVCVKPSIS LPQDNSSSPV  240
SGGEHVKSAA PNWEFQTNNN TANFFDNGGF SWSIPNSSST VSSQVKPNHN LEEIKWSEYL  300
NTPFFIGSTV QSQSTQPIYI KSETDYLASV SNMTDPWSQS QNENLVTAEA SDVFSKDLQR  360
MAVSFGQSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00134DAPTransfer from AT1G09540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0639390.0AY063939.1 Arabidopsis thaliana putative transcription factor (At1g09540) mRNA, complete cds.
GenBankAY0965230.0AY096523.1 Arabidopsis thaliana putative transcription factor protein (At1g09540) mRNA, complete cds.
GenBankAY5195520.0AY519552.1 Arabidopsis thaliana MYB transcription factor (At1g09540) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305129.10.0hypothetical protein CARUB_v10009497mg
TrEMBLR0GQ490.0R0GQ49_9BRAS; Uncharacterized protein
STRINGscaffold_100991.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.10.0myb domain protein 61